/neog/-SNK and Neo Geo General

KoF Destiny animated series out now on Steam and SNK's youtube:
store.steampowered.com/app/642890/THE_KING_OF_FIGHTERS_DESTINY/

SNK to extend their support program:
twitter.com/SNKPofficial/status/889676937798406144

Geese in Tekken 7 Trailer:
youtu.be/6MK2TKFFtQA

SSVS coming to PS4/Vita!
youtu.be/clmCdIwMoHo

KoF XIV Arcade version is Out!

KOFXIV now out on Steam!
store.steampowered.com/app/571260/THE_KING_OF_FIGHTERS_XIV_STEAM_EDITION/

KoF XIV is in the e-sports event by the OCA.
twitter.com/SNKPofficial/status/873134058447839232

Get KoF 98 UMOL in English:
play.google.com/store/apps/details?id=com.ourpalm.kof98.us

New MSA Extra Ops:
youtu.be/Z3KZdXXUINw

KoF Destiny game trailer
youtu.be/kOTUGI-nrDs

New KOF Chinese manga:
twitter.com/PrettyBakedCake/status/816915802083340288
twitter.com/PrettyBakedCake/status/817381037114171392

New SNK mobile RPG:
game.snk-corp.co.jp/official/newproject/

Latest tournament footage:
youtu.be/87MQrwRi3Cs
youtu.be/mOb1tNCN_X8
youtu.be/dNl_ypNMh5k
youtu.be/dBDcZgcNCzU
youtu.be/-_MVbscJXv8
youtu.be/RT4hkGwe7j4
youtu.be/cmA18dnqNx
youtu.be/v1JH568QpR0
youtu.be/HwD3v53neA4
youtu.be/gLNqxvNQxQQ
youtu.be/v=WFaLZMTwIjk
youtu.be/xFFq3r0ln10
youtu.be/BV-bjwj5gik
youtu.be/i4zqA4OI5do

DandyJ's beginner guide:
youtu.be/Ye3KVgI1LvU

Community resources:
dreamcancel.com/how-to-play/

Discord group:
discord.gg/HYAQYFh

KOFXIV gallery/OST:
pastebin.com/mYwAPcM0

Play older games online on Fightcade. compatible roms DL:
mega.nz/#F!EoJjwSLB!Tukuk9bZAa7YXXxKNVHorw

Links for the Steam Artbook
>PDF drive.google.com/open?id=0B2546QRNPRPxb1VyemE5N25kb00
>jpg mediafire.com/file/758z1r4yzo66w54/KOF_XIV_Steam_artbook.rar

previous thread:

Other urls found in this thread:

snk-entertainment.com/grandopencampaign/
youtube.com/watch?v=WKE_aCFYE0U
imaginarydigitales.tumblr.com/post/160660778028/after-hours-a-king-project-i-wanted-to-draw
mr-hes.tumblr.com/post/164755345232
mr-hes.tumblr.com/post/164754764697/kula-angel-nude-httpsstash01bvddds6sks
mr-hes.tumblr.com/post/160841024517/model-httpmarcelievskydeviantartcom
mr-hes.tumblr.com/post/160082373182/christie-monteiro
xcrofty.deviantart.com/art/The-King-of-Fighters-XIV-Luong-676688946
sticklove.deviantart.com/art/Zarina-677278352
sticklove.deviantart.com/art/Angel-680783254
youtube.com/watch?v=djfOIvclByY
twitter.com/gatoray_kof/status/904926641054408704
snk-onlineshop.com/item/【101予約開始】kof-xiv-バンダナ ralf/
youtu.be/52MDoW8-6X8
twitter.com/MiauNeko/status/905148702796460032
twitter.com/SFWRedditGifs

SNK official online shop: snk-entertainment.com/grandopencampaign/

At least the last thread was linked. Good on ya OP.

What's wrong with Terry's...entire body?

There's nothing wrong with Terry. He is a beautiful man and a wonderful mother.

Antonov Combos

Fuck me sideways, I forgot the link

youtube.com/watch?v=WKE_aCFYE0U

people are drawing other characters as shop employers, cute!

I want a Terry plushie

I want a KOD plushie myself

Anyone here?

No.

Maybe.

Damn, I never noticed she was tanned nor the inscription on the coins in her clothing.

Porn when?

Right now.

That bush

Wonderful.

Source?

Dunno.

Now the best girl.

Luong is so underrated.

an ayyy lmao plushie would also be good

Alice too.

Alice getting what she deserves. I like it.

Good. and before I get banned...Angel.

Have fun.

You are fucking trooper user

One for you

imaginarydigitales.tumblr.com/post/160660778028/after-hours-a-king-project-i-wanted-to-draw

Okay, guys. I just confirmed a thing. Not only nobody came here to this thread but there no mods too. Because I just posted a porn pic with spoiler in /fgg/ and got blocked in 2~3 minutes.

Better SNK shows a new game in TGS or this general will become very pointless.

Thanks. Nice set.

>almost banned
Some requests?

What kind of requests?

Managed to track down a bunch more

mr-hes.tumblr.com/post/164755345232

mr-hes.tumblr.com/post/164754764697/kula-angel-nude-httpsstash01bvddds6sks

mr-hes.tumblr.com/post/160841024517/model-httpmarcelievskydeviantartcom

mr-hes.tumblr.com/post/160082373182/christie-monteiro

Yeah. To be honest I missed the days when Game developers also hire animators/make their own OVA's and animes. I mean I have yet to see a Skull girls anime or a Mortal Kombat series(besides that 90's cartoon).

I dont know if Tekken or if DoA has their own anime's or just dedicated 3d OVA to further the stories/develop plots on their characters. I think the fact that SNK makes a fatal fury anime is the reason as to why FF become so relevant and well known. The animation and Mai showing nipple slips is not bad too. Imagine if Kasumi or Ayane or Mileena has nipple slips if their franchise got their own OvA's, imagine the multitudes of kids who will wank off to such official nudity that they will be compelled to look for the source of where said characters came from and play their game... and in time learn to love to play it beyond the waifus.

>Not showing Geese, Hein and Billys dicks.
>Alice playing the damsel in distress like Mai.
I feel sad.

In case anyone want the actual character models

xcrofty.deviantart.com/art/The-King-of-Fighters-XIV-Luong-676688946

sticklove.deviantart.com/art/Zarina-677278352

sticklove.deviantart.com/art/Angel-680783254

IIRC the game KOF Destiny is actually out in China

...

Thread's been in a similar state for a long time. Been warning against it from time to time since the graphics update was first announced.

Is it out already? I thought it was KoF world that was close to being out last time I checked. There was even a trailer for it which named some of the VA. One of them being Ayaneru for one of the OC girls.

This. I'd like an Ayy Lmao plush or one shaped like the various character's pets/mascots (Ukee, Mamahaha, etc.)

...

Looks like I missed a Terry/Kyo discussion in the last thread, shucks.

As the other resident Kyofag who happens to be a Terryfag who ALSO likes to shit on Ryu from a daily basis.

Someone stated in the last thread that in KOF 94, the way they seemed to present Kyo was in such an abrupt fashion, making him outshine other famous SNK titles such as FF, AOF, Ikari, and Physco Soilders.

The way user sort of described was right, considering that Kyo is a take on the arrogant ,flashy, hot-shot douchebag type of shonen protagonist, but he's also flawed realistically with his many past mishaps, and insecurities, such as the aforementioned learning disabilities.

He loses faith in himself when it comes to education, and becomes dreary, blue, and alone. A big reason as to why he may play the guitar is to relieve him of the stress in fear of being criticized for not going to college and ignoring his education. from that logic, he may even be autistic.

He was also down in the dumps during the events of KOF 99 after realizing he was separated far away from his friends/girlfriend, and the fact people used his DNA the make clones of him widespread, while the orginal man himself was missing out and bored out of his mind. He probably drank and was homeless like how Terry was in the OVA for a time, before Shingo and Benimaru found him.

Well, at least he always has Iori to relate to, considering their backgrounds are pretty similar.

Also the way they present Kyo winning his fights aren't as hard to believe as Ryu's. Kyo often needs the support of Benimaru, Daimon, K', Chizuru, and Iori to bring down tough opponents sometimes, and struggles to fully bring the opponents down until he fully finds their weakness.

Whereas Ryu's fashion of winning fights in SF alone are presented in the most Gary Stu way possible, especially when it came to Sagat when his edgelord kicked in to save him at the last minute.

Continued from It's actually quite a pain to see Ryu always having to win the fights "just for the sake of plot" when it comes to various peoples Sprite Animations/Fanfictions, it's easy to tell that they crank up Ryu's AI above all the rest just because "HE's DA MAIN CHARACTERRRRR" or "the most ICONIC FIGHTER OF ALL TIMMEEEEEE"

Gary Stu may be going a little far, but those were the vibes I was getting from Ryu. Then again, my hate for Ryu might be biased and may be considered unhealthy to people, but he generally really is the only fighting game protagonist I dislike.

Liu Kang from MK isn't really all that good either, the MC for those games should have been Scorpion and Sub-Zero, but he's still not as bad as Ryu.

Shun'ei I would consider meh as well, but I can't go that hard on him, considering he only had the chance to shine in one game.

Finally, I'd like to point out how I like that Kyo's main drive so far in Destiny is to try to attempt to fight Terry. The CG anime isn't really as promising to a lot of people, especially with them faces, but I like the fact that we can finally see a resolution of conflict between the two of them, making it a great rivalry after all these years of waiting. The two cool dudes of SNK will finally duke it out.

RIP Porn user

At least that is what people on diverse forums claim

...

The biggest example of Kyo's depth is the total defeat he suffered at Goenitz's hands that prompted him to take things more seriously. Very few FG characters have gone through something like that.

mai has plenty of nipple slips and still noone plays snk fighting games

Interesting. As for screenshots or something if you see it again. Would be cool to see.

...

I LOVE VICE!

That was fast

I don't think the OVA qualifies as plenty user

Kyo is definitely relatable, even his voice actor, Masahiro Nonaka, related to his character is saying that he was "young and reckless" like he was during teenage years.

Nonkaka found Orochi/NESTs saga Kyo more relatable then Ash/NEW saga Kyo though.

Really? I wonder why he didn't found Ash Saga Kyo as relatable

...

The fug? I like it.
youtube.com/watch?v=djfOIvclByY

What even is that? a squirrel with a snake instead of one of its paws?

Seems like it.

Perhaps as he grew older he became less young and reckless, and more responsible.

If anything, Ash Saga Kyo's outfit is relatable AF.

what true ogre hybrid is this?

They really like the idea of Kyo and Iori as clerks

That's exactly what I initially thought when I saw the video in my subscription feed. Either way I kinda like him. Seems kinda cool since it looks like he has some sort of stats buffing ability and the whole drinking booze then breathe fire thing is always neat. Since he's playable he must be some sort of hero given the game he's in. I'd like to know more about his backstory.

What the fuck is that? The squirrel thing I mean, I know that is from the Hero mobage

twitter.com/gatoray_kof/status/904926641054408704

Uh, KOF Destiny is part of the Fighting Game China Tour

No idea, but personally I want to know more.

Three KoF games with XIV having a singles and doubles event damn. Well, Destiny it is a beat 'em up for the most part, but I think you can go 1v1 against other players.
I've said it before and I'll say it again, I wouldn't even be mad if SNK gave up on the US and decided to focus where their stuff thrives. It's curious like how Gatoray mentions that the event's site domain is SNK china based. If one scrolls down it's in cooperation with a bunch of chinese companies.

I forgot to add, if the him drinking in the vid wasn't enough if one looks closely enough he has that red blush some people get when drunk. This is just my guess, but I think he's hammered 24/7.

Destiny definitely has a PvP mode

Don't die on me overnight /neog/

>literally uses sprites from Capcom VS SNK
Makes me mad.

...

Better than XII/XIII's.

ded

Whip wants to sell Ralf's bandana

What's with the deleted posts? Porn?

yes

>Whip wants to sell Ralf's bandana

I'd buy a bunch

No dead, just sleepy

here you go: snk-onlineshop.com/item/【101予約開始】kof-xiv-バンダナ ralf/

...

Better hope anons lives in japan or uses a proxy.

Huh, they also have Billy's.

KOD's mask when

Sylvie is for hugs!

...

Ralf should sell sexy pictures of Whip to get even

More Karnov's.
youtu.be/52MDoW8-6X8

...

Well, Kyo finally won't have to worry about getting a job

Why is the game so fast? Are they speeding it up?

...

so damn relatable.

...

...

Kyo and Ryu getting rekt by Iori?

I thinkg Kyo and Ryu beated each other. Iori didn't like to see someone else punching Kyo, so he attacked Ryu

Christ, Iori is worse than an ex girlfriend

twitter.com/MiauNeko/status/905148702796460032 humm

Man, that picture makes me feel old

...

>being this flat
>almost 'too' flat
>be blonde, has a cute face and a relatively masculine shirt-wear.
My trap senses are fucking tingling.

...

Enta-chan is just a young girl user

Karnov was always fast.

Now I see why it keeps being played